PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT29058
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 362aa    MW: 39117.2 Da    PI: 8.7399
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT29058genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-14118162347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Ia+ + ++Rt+ q+ s+ qky
         EMT29058 118 PWTEEEHRTFLAGLEKLGKGDWRGIAKNFVTTRTPTQVASHAQKY 162
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.212111167IPR017930Myb domain
SMARTSM007173.9E-11115165IPR001005SANT/Myb domain
SuperFamilySSF466891.0E-16115167IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-18116166IPR006447Myb domain, plants
PfamPF002492.0E-12118162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-12118161IPR009057Homeodomain-like
CDDcd001673.27E-10118163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MPQDSRPPGM RLFGVTIAPA PAPQLDPPDG DRDPSPNPPV AVREDVMRKC KSMGNLATLA  60
SACPSGDAGG AGDGYLSDGG LLQSSGKRRR AQERKKDNRD SILDLYWEQQ NQMTSSVPWT  120
EEEHRTFLAG LEKLGKGDWR GIAKNFVTTR TPTQVASHAQ KYFLRQTNPN KKKRRSSLFD  180
MMASDLSPAP NCPILPPTMA KFHDMVTMTN QLQNSSLEGV SSSNAANLAK QVTRDLPPPV  240
PSFTATNVDA SLSKMNHMDC FSRVPSLFRP IPIVPEGTPP ATANTSTLTF EANLTSCTSA  300
FLIPQSGPSP LPPATTAKTD HPAENKDLEL TVGLPSQQNM PSQQNMTNNI SSRNAVGVIQ  360
VV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170174KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519470.0JF951947.1 Triticum aestivum clone TaMYB64 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972854.11e-150PREDICTED: uncharacterized protein LOC101753432 isoform X1
TrEMBLM8C4Q70.0M8C4Q7_AEGTA; Myb-like protein J
STRINGMLOC_73122.21e-160(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58583652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.17e-34MYB_related family protein